PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12464_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 175aa    MW: 20045.6 Da    PI: 8.2255
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12464_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.3e-20970157
                 TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++ R+++t eq++ L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  RrC12464_p1  9 KCGRWNPTGEQVKLLTDLFHAgLRTPSTDQIQKISTELsvygKIESKNVFYWFQNHKARERQ 70
                 568*****************99**************************************97 PP

2Wus_type_Homeobox110.59.1e-36972265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt eQ+k+L++l+++GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
        RrC12464_p1  9 KCGRWNPTGEQVKLLTDLFHAGLRTPSTDQIQKISTELSVYGKIESKNVFYWFQNHKARERQKR 72
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.641671IPR001356Homeobox domain
SMARTSM003893.0E-4875IPR001356Homeobox domain
PfamPF000465.6E-171070IPR001356Homeobox domain
SuperFamilySSF466899.41E-121174IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-81270IPR009057Homeodomain-like
CDDcd000861.89E-41272No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGGGGTGTKC GRWNPTGEQV KLLTDLFHAG LRTPSTDQIQ KISTELSVYG KIESKNVFYW  60
FQNHKARERQ KRRKISTVDF DHCQETNLSL PHRDKPCHYR PPPKDTFETC EVDDKVIETL  120
QLFPLSKVER TRASITTASH NEYIREQVNT TVFSTYSSCG AETEHPPLDL RLSFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892011e-115AC189201.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB005N03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009122174.11e-104PREDICTED: WUSCHEL-related homeobox 7
RefseqXP_013715481.11e-104PREDICTED: WUSCHEL-related homeobox 7-like
SwissprotQ8H1D29e-73WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLM4CY351e-104M4CY35_BRARP; Uncharacterized protein
STRINGBra009132.1-P1e-103(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-69WUSCHEL related homeobox 5